dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q0RCM9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q0RCM9|Q0RCM9_FRAAA) Putative GntR-family transcription regulator {ECO:0000313|EMBL:CAJ64795.1} KW=Complete proteome; Reference proteome OX=326424 OS=Frankia alni (strain ACN14a). GN=FRAAL6172 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence length 230
Sequence
MVNSMKTLGAAHRPLRELVADELRQRILDGRITQGSRVIEDRLAEELGVSRNPVREAIRA
LESEGLVEVTPRRGVVVTVISAEEAHDLIEVRAALEVTAVRRAAARGVDPAVLAELAEIV
ATGSEAAAAGEFERLPMLNTRFHDLLARGSGNGALVEVLRDLQNRLQLLFSTGVQRRSGG
AWDEHRRILDAIRAGDADWAEAEMRSHIRGAASRYEDTRAGVAAATGGAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]