dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q1WTZ0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q1WTZ0|Q1WTZ0_LACS1) Transcriptional regulator, MarR family {ECO:0000313|EMBL:ABD99622.1} KW=Complete proteome; Reference proteome OX=362948 OS=Lactobacillus salivarius (strain UCC118). GN=LSL_0812 OC=Lactobacillus.
Sequence length 115
Sequence
MPVDTENKYTLCPKFTKTFGILGRKWNGLIIEVLLEKGPQRFRNLADSVDKCSDRVMVER
LKELEDEGLVERMAQPGSTRVLYKLTPQGEDLKEIMSDIHKWSDKWYSVEDCANS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]