dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q2QYC6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q2QYC6|Q2QYC6_ORYSJ) cDNA clone:J023077I15, full insert sequence {ECO:0000313|EMBL:BAG92267.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_120124400 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence length 475
Sequence
MPPRARTLLMPLAAATLLVASTIFLFAATGARWRPADTGLPVPAADFSAAVLESAVTDTT
AAAKELSFVDENGRPDDPASSSAAAARCDPTHAAVRVFMYDLPPEFHFGILGWSPPTDGA
ADAAMWPDVGSGAAAPRYPGGLNQQHSVEYWLTLDLLSSSSPPCGAAVRVADSRDADVVF
VPFFASLSYNRHSRVVPPEKVSRDKELQEKLVRYLMAQPEWKRSGGADHVIVAHHPNSLL
HARSVLFPVVFVLSDFGRYHPRVASLEKDVIAPYKHMAKTFVNDSAGFDDRPTLLYFRGA
IFRKEGGNIRQELYYMLKDEKDVYFAFGSVQDHGASKASKGMHASKFCLNIAGDTPSSNR
LFDAIVSHCVPVIISDDIELPYEDALDYSKFSIFVRSSDAVKKGYLMRLIRGVSKHQWTR
MWNRLKEVDKHFEYQYPSQKDDAVQMIWQALARKVPAIRLKSHRSRRFSRYDRGK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]