dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q3ILY5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q3ILY5|Q3ILY5_NATPD) ORC1-type DNA replication protein {ECO:0000256|HAMAP-Rule:MF_01407} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_6208A OC=Natronomonas.
Sequence length 489
Sequence
MGTDDSDASRPESRTPEDETTQADLSSSATSSNVPADVDHSTEAADGSPDAGSRSDESSS
QSIEDMLLEFDEQDGLIRDRSLLDPNYVVDEDRIVGRDDQLQEVTKMLRVTLGDNRPPNL
FLYGPSGTGKSLITKAVCNNINRICETRDIDFGTIEVNCQDLDTLGVAVYELATQAAEQA
GVAVQVPKHGVATKEKWDELFRIVNENFDSVVFVLDELDMLVGRRDKQEPAFSRLLYQLS
RAEATNDLRAYLSVVAISNDTKMMESVGSRALSSFTPEDVHFDDYDANQLQTILRHRQDA
FHDGVVDDDVIPLAAAFAAQTHGDARKAIDLMRVAGELAEREGSTRVREEHVRQAQEKVE
KNRVLEVVRGISTQKKLCLYATAAVAAQTDGGTARSTTGYRVYQFLTDSINADQYHQETY
VNKMKELTTYSLVDFERRSHGPSSGMFLEFQFGERPETILETLREDSRIEMVTSEEVQSV
VQAQIRKQT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]