dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q3ILY9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q3ILY9|Q3ILY9_NATPD) Lrp/AsnC family transcription regulator {ECO:0000313|EMBL:CAI50880.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_6200A OC=Natronomonas.
Sequence length 165
Sequence
MTGELDERDFRILCAIAEHETFSSEDLHEETGIPKSTVHYRIQNMKDEGVIKNELFEFDR
EKIGIEITLISEVWAEFGEGYHDTVGEKLSEIEGVNQVYFTMGDTDFVAIARLTSRDMVE
QLVEDYESIDEIQRTSSKFAISTIKEDISISALGDYSVETLLDSD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]