dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q3IMY5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|Q3IMY5|RL2_NATPD) 50S ribosomal protein L2 {ECO:0000255|HAMAP-Rule:MF_01320} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_4860A; OC=Natronomonas.
Sequence length 243
Sequence
MGRRILGQRRGRGTSTFRAPSHRYKADLSHRNVEESDLVTGEVVDIEHDPARSAPLADVQ
FDDGDRRLVLAPEGVTVGDEIQIGVSAEIAPGNTMPLAEIPEGVPVCNVERQPGDGGKFA
RASGVSATLLTHDRNAAVVQLPSGEMRRLSPECRATIGVVAGGGRTEKPFVKAGNKHHKM
KSRGGKWPRVRGVAMNAVDHPFGGGGRQHPGKPKSVSRDTPPGRKVGDIASKRTGRGGKG
GQE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]