dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q3M1X2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q3M1X2|Q3M1X2_ANAVT) Aminotransferase, class V {ECO:0000313|EMBL:ABA25014.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_B0304 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence length 395
Sequence
MKKITSTNKLDCIYFDYHSTTPVDQRVAEMLLHYMTTEFGNASSIDHIYGDMAKEAVAQA
SVNVANLVGASSKEVIFTSGATESINLVIQSNVSNNNSTKIRPRIAVLPVEHKAVLDTCN
MIAKKNLADIINLQIDSKGRLNLDFLNKICDSGISLICIMAANNEIGNIYPIQEIGQIAR
KYNIPFLCDASQAVGKIPINFEEWGITYLALSAHKLYGPKGSGALVVRKGHQLNPILFGG
GHQKGLRSGTLNVPGIVGLGEACRLRILEMDEDEKAIANLRDKLQNLLLDKVPGLVINGD
VNNRLSGNLHISIPDVSNSAIIARVRQKLAISTGAACSSGVQAPSHVLQAMDLPTDIIDG
ALRIGIGKFTKLEEIEQAAEILSLAVQQTRQVMYC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]