dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q3TWC1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q3TWC1|Q3TWC1_MOUSE) Ral guanine nucleotide dissociation stimulator {ECO:0000313|Ensembl:ENSMUSP00000097812} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Ralgds OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence length 907
Sequence
MVQRMWAEAAGPIGGTEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRL
ESSTQEIGEELINGVIYSISLRKVQLHQGATKGQRWLGCENESALNLYETCKVRTVKAGT
LEKLVEHLVPAFQGSDLSYVTVFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCIL
PYSSEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERR
AHLLLAQLEDLEPSEAESEALSPAPVLSLKPASQLEPALLLTPSQVVTSTPVREPAAAPV
PVLASSPVVAPAPELEPVPEPPQEPEPSLALAPELEPAVSQSLELESAPVPTPALEPSWS
LPEATENGLTEKPHLLLFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKGKEHLA
PTIRATVAQFNNVANCVITTCLGDQSMKAPDRARVVEHWIEVARECRALKNFSSLYAILS
ALQSNAIHRLKKTWEEVSRDSFRVFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNP
RRAQRRQKETGVIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKL
LQSACNNYSIAPEEHFGTWFRAMERLSEAESYTLSCELEPPSESASNTLRSKKSTAIVKR
WSDRQAPSTELSTSSSAHSKSCDQLRCSPYLGSGDITDALSVHSAGSSSSDVEEINMSFV
PESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVSTTRTHKRSVSGVCSYSS
SLPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPTVIRKAMDKHNLDEDEPEDYE
LVQIISEDHKLKIPENANVFYAMNSTANYDFILKKRTFTKGAKVKHGASSTLPRMKQKGL
RIAKGIF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]