dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q3UEV4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q3UEV4|Q3UEV4_MOUSE) Uncharacterized protein {ECO:0000313|EMBL:BAE28807.1} OX=10090 OS=Mus musculus (Mouse). GN=Lrp3 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence length 770
Sequence
VVCLVNLFLTGRLSSAVPALGKAGATWGFGFQAATEPTGTQAACSGKLEQHTERRGVIYS
PAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRL
CGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQTSCQTDEFRCDNGKCL
PGPWQCNMVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGTQD
CGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLE
LRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFN
ATYQVKGYCLPWEQPCGSSEGDDDSTGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQ
YPCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDC
QDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRL
EAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPS
RRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQAAPGPVPEPPAPNTDTGSP
REAGDGPPSGSGHAPEVGPSVPPPPLNLRDPEYRPEDKERKACVEPLEDSPAPVDTPPEP
CLAQDPHPQTPTASGTQDPHSAEPLGVCRSPPPPCSPILEASDDEALLVC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]