dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q4AA52 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|Q4AA52|RS16_MYCHJ) 30S ribosomal protein S16 {ECO:0000255|HAMAP-Rule:MF_00385} KW=Complete proteome; Reference proteome OX=262719 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110). GN=MHJ_0278; OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence length 88
Sequence
MVRIRLQRMGSKFNPFYKIVVADARAPRDGRFIEALGYYNPQQKFAKVNLEKTYRWLHIG
AQVTQTVRNIFSKKGVFKNFLEQKSSRA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]