dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q4X6G1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q4X6G1|Q4X6G1_PLACH) Uncharacterized protein {ECO:0000313|EMBL:CAH87515.1} KW=Complete proteome; Reference proteome OX=5825 OS=Plasmodium chabaudi. GN=PC302507.00.0 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence length 277
Sequence
DVKTVFKRCFNRDDPELSKSYEKIEDQAAKDHTTVGEVLSNYIAAVFTKMNDEFIKNDGF
KLSKYIPELEIINYAIMNGPKEMGDKIINSVNELNKLVVSESLTSIYESVVSGLNINCKI
KDDIITILNLADGKYFKIDLSGEARMIVPGQYSHEQVHMKKIPEYFIAKNRVCKTEKCPI
NSNCYVIENVETCRCIPGFSNNEETEGFKCDVDKSASCEKNNGGCDENATCLVLEDKIMC
ECNDKFNGDGIYCSNAIFYGMNTFIFFLISIVCVYIM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]