dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q58DA3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q58DA3|Q58DA3_BOVIN) Ly1 antibody reactive {ECO:0000313|Ensembl:ENSBTAP00000004763} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LYAR OC=Pecora; Bovidae; Bovinae; Bos.
Sequence length 382
Sequence
MVFFTCNACGESVKKVQVEKHVALCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGG
KGYEGKTHKGDVKQQAWIQKIHELIKRPNVSPKVRELLEQISGFDNVPRKRAKFQNWMKN
SLKVHNESILEQVWNIFSEASSSEPVGKGPDQQPPEPVTKPCAENNADVPSSKANSSTEE
PAEAKKNKRERKAERQKNTKKEKKELRLENHQEDAKSQKPKKRKAAQEAEQEAADGSSGT
KSQRKKSKAERAQDGAVDGGAKVGEQADAGPGKRKRKHSEVEANSKKKKIKPPENSEDGE
PENHEAPAKGKFNWKGTIKAVLKQAPDNEITIKKLRKKVLAQYYAVTNEHHKSEEELLVI
FNKKISKNPTLKLLKDKVKLVK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]