dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q5ZL54 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|Q5ZL54|KHDC4_CHICK) Pre-mRNA splicing factor protein KHDC4 KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=RCJMB04_7l9; OC=Phasianidae; Phasianinae; Gallus.
Sequence length 619
Sequence
MSAGGGGQRDAGTAGGRRSKWDQPGPAPAFLLSGAAPLPGRPFPGGGDGGTAVGVSESSA
APSGALDAAAAVAAKINAMLMAKGKLKPAPNTADKLQALGKGPATNKSKDDLVVAEVEIN
DVPLTCRNLLTRGQTQDEISRLSGAAVSTRGRFMTAEEKAKVGPGDRPLYLHVQGQTREL
VDRAVNRIKEIITNGVVKAATGSSPTFNGATVTVYHQPAPITQMSPAVGQKPPFQSGMHY
VQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAF
EPMYIYISHPKPEGLAAAKKLCENLLQTVHAEYSRFVNQITTAVPLAGFAQPAAINSVPS
QPSYYPSNGYQSGYPVVPPPQQPVQPPYGVPGIVPPAVPMAPGVLTTLPTGVPPVPTQYP
ISQVQPPASTGQSPLSAPFLPAAAPVKTTLPAGTQPQVQPHPQGQKRRFTEELPDERESG
LLGYQHGPIHMTNLGTGFSSQSEIDGAGSKPASSSGKERERDRQLMPPPAFPVTGMKSES
EERNGVGSLPGSHDHQAKKMKTSEKGFGLVAYAGDSSDEEEEHGGHKNASTFSQGWSLGY
QYPSSQQRAKQQMPFWMAP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]