dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q74M88 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q74M88|Q74M88_NANEQ) 30S ribosomal protein S9 {ECO:0000256|RuleBase:RU003817} KW=Complete proteome; Reference proteome OX=228908 OS=Nanoarchaeum equitans (strain Kin4-M). GN=NEQ446 OC=Archaea; Nanoarchaeota; Nanoarchaeales; Nanoarchaeaceae; Nanoarchaeum.
Sequence length 136
Sequence
MKHLVVSAKRKTSIARAYFREGNGIIRINGFLLEVWQNPLARARVKEPLIIAENIIPGIT
KEIDINVNVFGGGWHSQTEAVRQAIARGLVVWTGSDQLKKAFLEYDNWLLVNDPRRKEQN
KSLRSKPRAWRQTSYR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]