dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q7K4B6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|Q7K4B6|TMTC3_DROME) Transmembrane and TPR repeat-containing protein CG4050 KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG4050; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence length 926
Sequence
MSTNPNPGIHQYAPSTLPREREREGATNSPQRNLLEFLCICVACIVCYYNSTQCGLVFDD
ISAIRDNKDLRPHTPLINVFLNDFWGTPMRKEQSHKSYRPLTVLTFRFNYLLHALEPFGY
HLVNLLLHLSVCLLWRRVCRLLLRQCAASGSNAISAPSSSSVSQLNTCAFVASLLFAVHP
VHTEAVTGVVGRAELLSSICFLAAFLSYAKSVGDSGCPRRTNWLTLFGCFGSCLLASMLC
KEQGITIAGICVVYELFVVHQLRPLHLCHFVLRLFDERTEQQSPKLANPSGIRRWSSSTL
WKRLSFLVGITLTLLVGRVYVMGSQLPIFTRFDNPASAADTPERQLTYGYLIYLNCWLLL
CPSLLCCDWTMGTVPLLQGFTDSRNITTLLTFLALGAMVAKTCFTRNLALSRTLIMCLGW
MVLPFLPASNLFFPVGFVVAERILYMPSMGYCLLVAYGFEQLQRRGSLSWQRFSQAALAI
LLLTHALKTHQRNLDWRTEYSLFMSGVHVNQRNAKLYNNVGHALENEGKFEEALLYFQQA
VRIQTDDIGAHINVGRTFNNLKRYAEAEQAYVQAKALFPQAKPGVSYHARIAPNHLNVFI
NLANLIAKNQTRLEEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQEVYEQALLY
DNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAILLQELGGEEARRV
SRSRLYKVLENDDQNEKVYFNLGMLAMDESSFDEAEQFFKRAIHLKADFRSALFNLALLL
ADTKRPLDAVPFLNQLIRHHPSHVKGLILLGDIYINHMKDLDEAEKCYRSILHYDPHNTQ
GLHNLCVVFVERKRLAKAAACLQYAQRLAPAEDYIGRHLQIVLARLQKINKLPESAPERK
LAYEDYDPLEFKLPQDRPTHKSRKRS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]