dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q7NF38 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q7NF38|Q7NF38_GLOVI) Gll3688 protein {ECO:0000313|EMBL:BAC91629.1} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=gll3688 OC=Gloeobacteraceae; Gloeobacter.
Sequence length 341
Sequence
MRWLEVAAMMMSFVRSLLLFSGLMVYSASVGTAAELPTGRLAREAVQAQWKLPRLKTDGT
VTVKAKLLSDGHLIDPQLTLGGPLAIEGGEAAELTRRSLEEAIRRAVVDTASRGPVEFTL
QIRSSGRVPGCFPLRVALPVALKDTQETIPEVLFKGLEQGLIKWNAMVVGYAEGKLPEPL
VVVPSPEQADVVVEAFEDYPDYSSYFIDERSGRVVVRMPFKRDVGAWVTQGFRWWHPEQI
TQQTMFQLGRQMGLGLSENNTNVLYPDQSLTIVTSPQKGLGVGTRNVQTIIDGNLVNEYG
GGDRTITSFQLEDAGDFVRTRRCAAERAPASPNVINRPETP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]