dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q7NFH7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q7NFH7|Q7NFH7_GLOVI) Ribulose-phosphate 3-epimerase {ECO:0000256|PIRNR:PIRNR001461} KW=Complete proteome; Reference proteome OX=251221 OS=Gloeobacter violaceus (strain PCC 7421). GN=gll3548 OC=Gloeobacteraceae; Gloeobacter.
Sequence length 233
Sequence
MAKPVVVAPSILSADFARLGEEIHAIDEAGADWIHVDVMDGRFVPNITIGPLIVKAIRPV
TQKVLDVHLMIVEPEKYIADFAKAGADIITVHCEHNSTVHLHRALSQIKELGKQAGVSLN
PSTPLSLIEYVLDLCDLVLVMSVNPGFGGQSFIPQVLPKIARLKSMCEERGLDPWIEVDG
GLKPSNTWQVLEVGANAIVSGSGVFGVGPARYAEAIEGVRASHRPAVEVAAQV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]