dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q7P8M3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q7P8M3|Q7P8M3_RICSI) ATP-dependent helicase Rho {ECO:0000256|HAMAP-Rule:MF_01884} KW=Complete proteome OX=272951 OS=Rickettsia sibirica 246. GN=rsib_orf1385 OC=Rickettsia sibirica subgroup.
Sequence length 458
Sequence
MNTTNKESTAELNNTESNNNYNNFAENGNIINLKQLKRKLPEELQAQAEELKIENINSLL
KQELVFAILKKSVEQGVLIVGEGVLEVLPDGFGFLRSPEVNYLAGPDDIYISPSQIRRFG
LRTGDTVEGQIRAPKAGERYFALLKVNRVNFEDPSKAYHRVHFDNLTPLYPDEKLGLELE
NNSKDSKDFSTRVIELVAPMGKGQRALIVAPPRTGKTVLLQNIAHAITTNNPEVFLIVLL
IDERPEEVTDMQRSVRGEVVSSTFDEPASRHVQLAEMVIKKAKRLVEHKKDVVILVDAIT
RLARAYNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIENGGSLTIIGTALIETGSRMD
EVIFEEFKGTGNSEIVLDRKIADKRIYPAIDITRSGTRKEDLLVDKIILNKMWVLRRIID
PMGSSEAIEFLLKKLENTKTNGEFFEMMKSPERPKNGL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]