dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q7U7U9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q7U7U9|Q7U7U9_SYNPX) Uncharacterized protein {ECO:0000313|EMBL:CAE07396.1} KW=Complete proteome; Reference proteome OX=84588 OS=Synechococcus sp. (strain WH8102). GN=SYNW0881 OC=Synechococcus.
Sequence length 1159
Sequence
MFRQGYLKFKIYFNLLPLQSLQFTSEKTKDNDLVDSSKMSQSYSSVGKLDRKSFKPSGSD
YILSPPSSYSKRFATKFKNFNAKSDVISIDLSDFNTTLTGIYIARSKKEFKKAQKSDSAF
IYNWKNGRLFFNENGSAKKYGDGGLIARFAKKTRLNEENIIFNFGIHSTSTPDPTPTPSY
SITADKISVDEGDRVNWTITTKNVRKGTRIFVSDVFERSNNIYDNYSDMDGYALGSDGWE
SYYFKVNSKGKVKFWDEWNEDGITEGDDSYYYQFYEDPDFTELLATSKTVEIIDTSQAPS
ATPTPEPTPAPSATPTPEPTPEPSTTPTPEPTPEPSTDQGFLDDFANNSSTSGVISVGDI
VSSDLETTDDEDWFQISLTEERVYQFDLEGIQLTDPRMSLHGPSLEELIYDDDGGSGYNS
KIEFIATSSDNYFISAKSWGETGTYTLKAIDITPTPEPTPEPSTGQGLLDDFANNLSTSG
VISVGVIVSGDLETTDDEDWFQVSLKEGRVYQFDLEGIQLTDPQMSLHGPSSEELIYDDD
GGSGYNSKIEFIATSSDNYFISAKSWWETGTYTLKAIDITPTPEPTPAPSTTPTPEPTPE
PSTTPTPEPTPAPATTPTPEPTPAPSATPTPEPTPAPSATPTPEPTPAPATTPTPEPIPV
PTPEQDSSPTPTGNPTNTTDGVFLYGPRPMQSAIKTFSGTVGVGGEVDRFEISFLAGDVV
SLSVEAADNTWPLLRLVDAEGRILDPVSAYNNNSASTSGYRVDVDAMLFAEVYAQNSFTG
SYKLYVERFINESPLRPIPNELLILVEQDATNSADQYSSRYLYSDSGLIYISFDSSLSDE
LKSWWEDVFAATDAVIEPEFVVVPQSHPKSQLVVNQTSSYYVSGDHAGIYQSPSYTYSEL
SDESAYNFQRKNNQGEILLAEAAFSHSTRFGGSREAGWKSVAFHELGHALGLEHPHDSSD
GDVDRIIDTNGTVMSYEKTQDSDGDPGFTDLDVNALQFVYGTETGVLTPSPLEGIPLLIE
SRTFDLSKRWKSPILSAEWIGGYTIQEPSSGLSTKVLQLTRSEGYLENESKIWLDFDLGD
GLKNWNSLNGYSEGFHDVLILGNSVTFEPGEATALFDLPIVAGSHAESDEWVDVTVRPEY
PDLYKAVPDSALRLTIVDA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]