dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q8IRQ6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q8IRQ6|Q8IRQ6_DROME) Anaphase promoting complex subunit 7, isoform B {ECO:0000313|EMBL:AAN09176.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG14444 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence length 528
Sequence
MMRHKNAVLVAIESSYPEFGDAEQRRRAAECYRQIGNTDMAIETLLQVPPTLRSPRINLM
LARLQHHGSRHGTTKKSEAVLAYKEVIRECPMALQVIEALLELGVNGNEINSLVMHAATV
PDHFDWLSKWIKALAQMFNFKHSDASQTFLMLHDNTTLRCNEHLMMALGKCLYYNGDYFQ
AEDIFSSTLCANPDNVEAIGLMAVLCGQEGGCEQDSADMDYLFAKVSSEVKYTASHWFAH
AQLLYDEGKFERGLNFVEKCLDSEPRNHEALILRGRLLIALERHTQAVCAFRTAQMVAPY
RFEIYRGLFHSYLAQKRFKEANALCNWTIRLFQNSPRSFTMFGRTLFLFPDPRMRRTARK
FAEKSLKINHIYTPAVNLIADICQVEGPTKAIIKLLEKHVIIFPKVNLLNHLGDIMRKQK
EPVKAMEYYYKALRQDPKSKRTLRGLRLLAKSDDESPVLDESDDIGMDNQQSINDLTTLC
EATNAQGAEGAESVENSREASSSAAARSGQEEDVDEHDWIDVPDGMSY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]