dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q8LGI8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|Q8LGI8|NAA20_ARATH) NatB N-alpha-terminal acetylation complex catalytic subunit {ECO:0000303|PubMed:24244708} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F10O3.2 OC=Arabidopsis.
Sequence length 174
Sequence
MTTIRRFSCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRVMGYIMGK
VEGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIK
MYEKLGYIIYRRVLRYYSGEEDGLDMRKALSRDVEKKSVIPLKRPITPDELEYD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]