dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q8ZXQ4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q8ZXQ4|Q8ZXQ4_PYRAE) Uncharacterized protein {ECO:0000313|EMBL:AAL63292.1} KW=Complete proteome; Reference proteome OX=178306 OS=/ NBRC 100827). GN=PAE1161 OC=Thermoproteaceae; Pyrobaculum.
Sequence length 100
Sequence
MFTVELYPALYLRAEGARRYRVNWYRVFGRSDFLWHPRHQFISRRHFAVGYEEGVYFVED
LGSTNGTFLNGVDIRGKGRARLQPGDVINVAGVLELAVEF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]