dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q92W50 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q92W50|Q92W50_RHIME) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=266834 OS=meliloti). GN=SM_b20514 OC=Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
Sequence length 405
Sequence
MATIIRIRHDPLISADISAPIVPAGKIFPSRLRFSRDRTYPFVERFCPMEHTMGRRDVIA
IGGSLGAVAALKHLLGKLPGDFAAAVFVVIHVGARGKDLLAEILNAHSGIPVTTAVDGEA
VERRHVYVAPADHHLLVIDGVIRLGRGPRENLARPAVDPLFRSVGLNYGPRAVAIVLTGM
LNDGAAGLADLKRCGGVTVVQNPSDAVAPDMPMGALRASDVDYRAPLEDLAALLVELTGE
EAGPPILVPAEIRLEVDIALGLQIGSETMLTIANPVPISCPACGGVLSQIKSWPPLRFRC
QVGHAYTSEALAAASEGAVDEALRVALRIIEERVTLSEKMAQDAHRSGFAAAAAANRRRA
NEGREHAETLRRAIIGSGTDATAGELEDADLAVAKHPDTIDPESS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]