dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q9GJY3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|Q9GJY3|S26A2_SHEEP) Solute carrier family 26 member 2 KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=SLC26A2; OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence length 734
Sequence
MSLKNGEQNDLSPKDSVKGNDQYRSPSGIHVEHEEESRNDFWQFESSNLFRHPRIHLEPQ
EKSDNNLKKFVIKKLEKSCQCSSTKAKNTIFGFLPVLQWLPKYDLKKNILGDMMSGLIVG
ILLVPQSIAYSLLAGQEPIYGLYTSFFASLIYFILGTSRHISVGIFGILCLMIGEVVDRE
LYIAGYDTVHAASNESSLVNQMSNQTCDRSCYAITVGSTVTFVAGVYQVAMGFFQVGFVS
VYLSDALLGGFVTGASFTILTSQVKYLLGLSLPRSGGVGSLITTWIHIFRNIHKTNICDL
ITSLLCLLVLLPTKELNERFKSKLKAPIPVELFVVVAATLASHFGKLSEKYGTSIAGHIP
TGFMPPKAPDWNLIPRVAVDAIAIAIIGFAITVSLSEMFAKKHGYTVKANQEMYAIGFCN
IIPSFFHSFTTSAALAKTLVKESTGCQTQVSGVMTALVLLLVLLVIAPLFFSLQKSVLGV
ITIVNLRGALCKFKDLPQMWRISRMDTVIWFVTMLSSALISTEIGLLTGVCFSMFCVILR
TQKPKASLLGLVEDSEVFESMSAYKNLQAKSGIKIFRFVAPLYYVNKEYFKSVLYKKTLN
PVLVKAAQRKAAKKKIKRETVTLSGIQDEVSVQLSYDPLEFHTIVIDCSAIQFLDTAGIH
TLKEVRRDYEAIGIQVLLAQCNPSVRDSLARGEYCKKDEENLLFYSVYEAMTFAEDSQNQ
KERYVPNGPSFSSD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]