dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q9SJ07 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|Q9SJ07|Y2192_ARATH) Putative B3 domain-containing protein At2g21920 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At2g21920; OC=Arabidopsis.
Sequence length 278
Sequence
MSFDVRSEKIDLIKGPELPDYNMFMSQKFTSYEGKLAILLTGNGDCSFYMWILEDAAKHE
WSKKAYVVPDFFPLDPFVLLMQRANENDIVRTFHYDDRVGTSDAIVESTPASPPRHIMFS
VIIRKDSPLRNLRGAKSIFKVSFTIILKTFIVKLIMMKDFQLDGDMIISKTLSRTDVDHH
GRLFLPKNQVLSVLKKMRNVTKESLRKGIELEVVDIIENDSYSVILKSRNTTNDFVLASG
WSIMKHSLDLQEGDDIKLFWDYLNYKFIILNFEYNLIP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]