dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

R7TZG4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|R7TZG4|R7TZG4_CAPTE) Uncharacterized protein {ECO:0000313|EMBL:ELT99164.1, ECO:0000313|EnsemblMetazoa:CapteP142796} OX=283909 OS=Capitella teleta (Polychaete worm). GN=CAPTEDRAFT_142796 OC=Capitellida; Capitellidae; Capitella.
Sequence length 481
Sequence
MIIAVGLIVLLASAHGDVPADGSLRLTGGAMETTGNVMVFYQGKWGIVCDDGWSLRAADV
VCRSLGYLRALGHTDQAYFGTPNEDVFLDNVRCRGDESSLLECDRNPWHDHDCEKSEAAG
VFCAPLPGSLSSPLRVNVSNSTPRITSPHEQHTPTQGPETNSIRMPIRLRGGRNEDEGRV
EVRVQGHWGAICGDHWTLLEATVVCKQVGKGHARSAVMSSVFGGEHLAKVLSGIDCMGEE
DSLDECSHARRSHDIACPEQDFIAGVVCTHELPDLVPNATLLESSTYLQDKQMYYLTCAM
EENCASASAYEIKKTVRDWHIHQRRLMRFSSSTWNFGTADFRPESNKADWEWHLCHMHFH
SMEVFAHYDLLDLQHNKVAEGHKASFCLEDVQCLPGKQKKFACKGYGDQGISVGCADDYL
HDIDCQWIDITDLKPGTYIFRVHINPNNHVAELSYSNNAVHCDLSYTGLSVTVTNCENGP
I

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]