dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

S4RCL5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|S4RCL5|S4RCL5_PETMA) Potassium channel, subfamily K, member 13a {ECO:0000313|Ensembl:ENSPMAP00000002947} OX=7757 OS=Petromyzon marinus (Sea lamprey). GN= OC=Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon.
Sequence length 462
Sequence
LTEKSPRSAPRPATQNSAPRPATQTTMARVSLGGEDTARFALLAALILCYLLCGAAVFSA
LERPSELVAQERWLHRLENFTQHFGVPRADLDALLRDFELGATAGVRAAPLRPRWDFTGA
FYFVGTVVSTIGFGMTTPTTVSGKIFLIFYGLFGCAAGILFFNLFLERLITLLACVMRSC
HRRQINRLVIQPGRKASDQSDAIECLAGWKPSVYHVMMILGIAAVAIACSASAMFSAVEG
WSYVDSLYFCFVAFSTIGFGDLVTGQRDLYDHQTWYRVGNIVFILAGVCCIYSLFNVLSI
VIKQTLTWMLHKADCRSLCRRRPRLRARNQRRNAVMPGVPRGRRNNNNNDAAGGGGGGGG
VETVAAPGPRRYDGGAGNDSDTDGRRLSGELISMKDFLASNKVSLALMQKQLSEAANGHH
HRVAHRCSPVHSHSLGRENGFAAGVGALAIMNNRLAETSEDR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]