dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

S5Z9D0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|S5Z9D0|S5Z9D0_9CREN) Uncharacterized protein {ECO:0000313|EMBL:AGT35975.1} KW=Complete proteome; Reference proteome OX=1365176 OS=Thermofilum adornatus. GN=N186_08185 OC=Thermofilum.
Sequence length 652
Sequence
MARGPTEKMIAAMLVLLLVVYTQTSTVTHHVAVEVKAEPLVDWLELARSAWNYFQPGVGL
SSLGLNYASISWHYLTDWDLGCYISAIVDAEALGLVDKEGTMGSDARIRKVLNFLATRPL
HPSGVPYGVYDADTGEPGTTSPSNPSDAGRLLIALYRLKQHRPEFSNYIDYVVERNGMLK
FAGGVPNNGFYSYYYAYGYYLWGARTRQVNDALNVLSTLRSKQVVDAYGVKLPFVEITME
PILYSIFELSLPEDFFYWANLTLQAQFNRYKATGKLTAFTEGNLAVPPYYIYEWIVDIYT
GKTFTLWSPSMGHTSLTPVVFTKAAIGMHAIWENEYTSLLLNYVMKAKTPNGFYEGVDEN
GNIIYIMTDKTNSLIINAARYALQKAKPPSLVVQETLETFPGESVTLPVLVNHSLSLPVH
LNVSSGIEGLTLSLQNSSGKTPLKTNLTITVYNMIRPGSYQVIILATSPLAKPVNRTLTV
IVKPPGYTLKIKALNACGEPASNVTIVLGDFKGLTARDGTLTFRHLNGTYMLYAFLGRVQ
VADPTTITISSDTELTLKLKLYKVLIDAKTTKGTPAEGIILRAFVDDQFLSYAKTNSSGL
AVLKNIPPGNITVKAYSSDGKIELGSWSITVRGDVDVVDPEIVVPEIGKIEA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]