dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

T1EXQ7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|T1EXQ7|T1EXQ7_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESN90421.1, ECO:0000313|EnsemblMetazoa:HelroP166087} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_166087 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence length 601
Sequence
MKNDVDDVESNDGSTEEQIVLTSETGGRHPVVRSMLLRTSDYFQGLVNSGMRDAHYRELT
FQCLTNESLKEVRDYLSRLSTNEVEGRRPRLKSLNKVEAGLDGAFYLQINDMIDNYVEFL
LKHLNMSTCIRILNIANKYVLTDQVIEKVFRYMLKNFKDIPESFKISLSPDEMFRLVASE
EINADSEIDIFNLIIKWVSDDQTRKCFVEKLLTEVRYCLMTTAEKQECTAVLNDLKLNIC
HNKDKDSNISRTLGMLFAIGSTESKDQDGNFFNILRVYDFVEACKICDNSTAKPKPIRFN
PSGRRGPPRDLDGYNACVVGNCLYLVGGKPRKTSITCKVSRYNPVTAAWSKCCSMNLARR
QFYLGGLAGQLYAVAGVTANCSETPTVEKYTPSENRWYMVEPLPLALSHLAGCVWNGMIY
VSGGWDDCRDVRNVVYRYDPSCNKWFPRAPMLTERRSHVMTCTGNKIFVFGGKKVTQNAM
DGEMYDVENDQWSSVLKLKMPVCDSPSITINNCLYIFEHEFFSIYWFRKYIQKINLAKYL
KEKKTSNDSSLSSVQGGNANNNNLEQNSHSDDDCQILSYKRQKDRIPFECQYVGVMIMSD
I

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]