dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

T1FSS2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|T1FSS2|T1FSS2_HELRO) Uncharacterized protein {ECO:0000313|EMBL:ESO06908.1, ECO:0000313|EnsemblMetazoa:HelroP191240} KW=Complete proteome; Reference proteome OX=6412 OS=Helobdella robusta (Californian leech). GN=HELRODRAFT_191240 OC=Rhynchobdellida; Glossiphoniidae; Helobdella.
Sequence length 528
Sequence
MYVKKVQQYCFPWHFNASCGPDEMIMMTSAMYGRSSKGRCSGRRSCHVVTPDPILYQLKP
CPNDFSVSLEADYSCVKVEMGKPYTCNHFGDPQIVNEPRGYLASLVVEELKIGGPRCPWM
ITASRGQQINFTLHDYGVALRRDDVISIQTMASPQSLIRHENELHLLQAYHDARHRTRRN
QLEHAPSCKVYVTLRDVEARSANSAIIDVADCTSKERIRHVMLSEGPKVEVTMMDLKVKE
EIIYYALHFEAVGCADPIVPRGAHLRRNGIQATITCNFTIQSWHIVCQGDGWYGSVDNCT
VETPTKSSMVLNDSTEIYPLDYKNKGGGTIKAGSTSVDALGHVEVVVPNDLEGGGLSLLV
AVMVGLVLGVLIGVVLLTLVLSCHKKLYSKKRLREAKELSSQRVLYSTRRDVINDNDDDN
YNADSNNINNYAPTTTSTPNYHHLHTNNNNTNNNTTSTTTYCPSYHYSPGNGFGSTGSTL
LAGRNYLDFQDGIRYTHVCGLGAMDVVPPCERNESNNNNVCNDNRQAS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]