dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

T1H0J8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|T1H0J8|T1H0J8_MEGSC) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:MESCA009677-PA} KW=Complete proteome; Reference proteome OX=36166 OS=Megaselia scalaris (Humpbacked fly) (Phora scalaris). GN= OC=Platypezoidea; Phoridae; Megaseliini; Megaselia.
Sequence length 417
Sequence
MPSLPSQPLQQHQQQQQQNQPFQQQLQYYNGQQDESYSAAQQLKWPQVIEIKDFNTLYHA
NIPPYQFWNLELLNKHPTFIRFSFTMPWGGNFAIYGRRNVAASVTQYDFVEFVKGGRIDN
RVKRRRRSTDINVHLNQNVESNIVDAEQQDEIEHDFDGDEIIEEDVSTPLDSGKVIVQRL
NRTHRIAKRSATSSGPITLDNNMETAIVNVTVLQYLDSGKWVISIYNDDLVAHTVTAVTE
EAEGVTTTCPNDCNGRGSCYLGKCDCIDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCEEG
WKGAECDIPQGECEEPNCSNHGRCIDGECRCERGWKGPFCEQHDCIDPACSGHGTCVSGQ
CYCKAGWQGEDCGTIDQQVYQCLPGCSEHGTYDLETGQCVCERHWTGPDCSQDRHKI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]