dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

T1L458 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|T1L458|T1L458_TETUR) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:tetur37g00870.1} KW=Complete proteome; Reference proteome OX=32264 OS=Tetranychus urticae (Two-spotted spider mite). GN= OC=Raphignathae; Tetranychoidea; Tetranychidae; Tetranychus.
Sequence length 454
Sequence
MTSLLNKIQGAFSEAISQSPKLVIDKRTVEKTWKLMNKVVKLCNNPKIILKNSPPFILDI
LPDTYQHLRLIYNKYEDRMNYLNENEYFRVYIDNLNKKCKETIRLFKEGKDAMFDETGPC
RRNLTKQSLVFSHMLSELKAIFPDGLFAGSNYRITKSDAAEFWKNHFGDRTIVPWRIFRQ
TLHQEHPIGSGLEAMALKSTIDLTCNDYISNFEFDVFTRLFQPWSTLLRNWQILAVTHPG
YVAFLTYDEVKARLQKYINKPGSYVFRLSCTRLGQWAIGYVTPEGNILQTIPQNKSLCQA
LLDGYREGFYLYPDGRNVNPDLSWAVQATPEDHIRVTQEQYELYCEMGSTFQLCKICAEN
NKDIRIEPCGHLLCTPCLTSWQDSEGQGCPFCRAEIKGTELIVVDPFDPNPRSATKEANR
DQNLVDIEEDENFEKKYVSSYLRFTLEKNRIKMN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]