dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

T5HDN7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|T5HDN7|T5HDN7_BACLI) Endoribonuclease L-PSP {ECO:0000313|EMBL:EQM26905.1} KW=Complete proteome OX=1368424 OS=Bacillus licheniformis CG-B52. GN=N399_15375 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence length 129
Sequence
MKPVHTKYSTRDGGHYVPAMEHNDVLYISGQLSMNPETGKIPAGGIKEEAKQALANMELV
LKERGLAKEDVILCRLYTPDVKYWPDINEVYAHFFGNHKPARVVVPSNHLYAGCLVEVEA
IAAIKEEAQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]