dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

U3EYN1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|U3EYN1|U3EYN1_CALJA) Low-density lipoprotein receptor-related protein 3 {ECO:0000313|EMBL:JAB49932.1} OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=LRP3 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence length 770
Sequence
MDKRAAPGLEGAPGARAQLAVVCLVNIFLTGRLSSAVPALAACSGKLEQHTERRGVIYSP
AWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLC
GSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLP
GPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGLQDC
GDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQESRRVLLQLEL
RLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNA
TYQVKGYCLPWEQPCGSSSDDDGGSAGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQ
YPCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDC
QDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRL
EAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPS
RRRLGRLWNRLFHRPRAPRGQIPLLTAARPSQTVLGDGLLQPAPEAAPNPPAPLMDTGSP
RAARDGPPSAPGHVLEVGPSGPPLPLGLQDPECRPMDKDRKACREPLADSPAPVDAPREP
CSAQDSHPQASTASSTLSPHSPEPLRVCRSPPPHCSPMLEASDDEALLVC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]