dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

U3K0A9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|U3K0A9|U3K0A9_FICAL) Mannose receptor C type 2 {ECO:0000313|Ensembl:ENSFALP00000008463} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=MRC2 OC=Ficedula.
Sequence length 1468
Sequence
MFPPLRGPLCCLLCSLLGLQLVLGAAHPDSKVFLIYNTGVQSCLETKDSLVRLAEGCNAS
APGQQWKWVSRNRLFNVGAMQCLGVSWHGANATAGLHLLATYECDRESVNMRWSCRGLGE
QLSQHLGARLGNSSLDRGDQAHGSQWRTYGTEEDLCSMPYSEIYTIQGNSHGKPCTIPFK
YDNQWFHECTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWDKDHLTNSCYQFN
FQSTLSWREAWNSCEQQGANLLSITEIHEQTYINGLLTGYSSTLWIGLNDLDINGGWQWS
DNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCGIALPYVCKKKPNSTADPFLT
DLWSEVKVDCEPSWQPFQSNCYRLVGEKKSWQEAKKTCLRSGGDLVSIHTLSELEFVTKE
IKQDVEELWIGLNDLKLQMNFEWSDGTPVRFTYWHPFEPNNFRDSLEDCVTIWGPEGRWN
DSPCNQTLPSICKKPGRVSQEKEEDDHGCRKGWKWHSPSCFWLGEDRVPYSDARKMCSDY
SSTLVTITNRFEQAYVSSLIYGWDGEYFWTALQDINETGTFRWLSGDEVMYTHWNRNQPG
YNKGGCVALATGSSMGLWEVKNCSTFKAKYICRQNLGTPVNPELPGPFPTPSLTATCPPG
WSSDPKLRHCYKVFNFEKLQEKKTWIAAQEFCRELGAQLLSLGSYEEEHFVANTLNKIFG
ELEPELHEQHWFWIGLNRRDPAGDQSWRWSDGLGFFYHNFDRSNYDDDDIRSCAVLDLAS
LQWMPMQCEAQLDWICKLPKGADVKEPEITTQGSKEWVKYQEAEYKFFEHHSTWLQAQRI
CSWFQAELTSVHSKDELHFLGQNLKKFSRGQEQHWWIGLHTYENDGRFKWSDGSLLNFVS
WAPGKPRPISKDRKCVYMTASREDWGDQKCMTALPYICKRSNGTAVKPSLPPVPAATSGG
CPQGWLPFLSKCFSFNGHNKDEIVKWPEAKQVCESQGAILATIASPLEQAFITSMLPNIS
FDLWIGLHDAQGEFQWVEEVPLRHTSWAPGEPSGCSSSSPLDEPTNCVVVWHGSPPLFTG
RWDDRSCLEEKHGYVCQRSIDLSLSPAQAPFPASPSGTLFYHNSTYRILQKPLRWHEALL
LCETLNATLATIPNPYSQAFLTQAVSSLRAPLWIGLANDEGGRSYSWLTEENLIYTNWQD
GEPQQITGCSYMDTDGTWCTASCDTKLQGGICQLQTGHSRTHKWSYSGSCPKSLEDSSWI
PFRDHCYTFHMEIALGQKDAMRRCQKVGSTVLSIQDEMENIFVWEHLQAYEGLSKGAWLG
MTFNPKGGTLVWHDNTAMNYSNWGQHDTGPSMLSQNSCYWIQSSNGMWRLGSCTNVTMGV
ICKIPRVEESTFSRAALPENTATIAVVVLSVLALCAVLGVVVFLYKRRQNAERGAFESAR
YSRTTSNPSESAEKNILVSDMEMNEQQD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]