dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

V4BYX3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|V4BYX3|V4BYX3_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO94324.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_189647 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence length 626
Sequence
MTSKVCVSVCLVLGCVFAIYGKVSPIDLDLNLDGKESKDIGFDGLTSLASFSTVSDPKLD
ENSTNAKNAVLPGDIREFSLTQWTAKQEIQPKNGTSFTRVKRASKKGKKKRGKGRKRKGR
KGMKKKKGKKRKGKKKGQKGKTIKKGKKKGKRKKKKGRKGKKGKNVKKLKGKRKGKKRNG
KKKGKKGNGKKKGKKGNGKKKGKKGNCMKNCKKVYDKKKDKGKKIIKSKKEPEGKKESDD
NLKELLEKIKEEKDDAVNSPELKKIYPVKVKIETTMPVNKEKMKEIKELSSIKKKTDKTL
TKIDPCELKPCRHNGICEKLGSTIKDYKCVCPAGRKGKHCEFSAEKIKLKSDQGKPKKHK
KHKAKQEDDANLALIISLSTVIPVTVVIALILTIHCVRVKNKRAQLLAKFRRDKRFGKVP
EPVPGVMALSNQMFCGCCSKQKKKAPAYTIKDIEVELEKQATIEKLNELIDKASGTKASK
LGGGKAKKGIKGGKSDASMMSEGSEGSETAGSSWGSDVSGVYGSEVSGISGSAVSAVSAV
SAVAAPVSEAKASDEQIEQLADKVAEAKLSVEQVDQLTELVQKVSKAKMEQEAQLTELDQ
QVSTAPMEEEQHPPAPPSPPPLPPLP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]