dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

V4T9C4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|V4T9C4|V4T9C4_9ROSI) Uncharacterized protein {ECO:0000313|EMBL:ESR48115.1} KW=Complete proteome; Reference proteome OX=85681 OS=Citrus clementina. GN=CICLE_v10000881mg OC=Citrus.
Sequence length 358
Sequence
MEGRTSGSVTLIGPSWDTWHIDLIQQDDNLFFDKGWPVFLRDNFIECGDLLVFRYDGELH
FTVQIFDQSGCEKEAAFNSKSTSTGQKREREEAVAHSDKALQSLLKKIRECSSSFESDCI
DDNRDREADSCEETRRCLSLSTIFASPSQPKTCNIKPEDEEKKVAQSFISAFPYFVRKMK
RFNVSGSYTLNIPYQFSMAHLPNFKTEVVLHNLKGASWTVNSVPTTKVHTSHTFCGGWLA
FVRGNEIKLGDICIFELVHKCELHVYILRVGKQYPDSQRGTTVLTGSNVSSTTISCKQFD
GVPKKVKKNSLKKIQLCNVKGSKSCEIKKHIGTDGNSVSIATCCLPKISHEKSGKAVN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]