dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

V5V3W8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|V5V3W8|V5V3W8_9CYAN) Imidazole acetol-phosphate transaminase {ECO:0000256|HAMAP-Rule:MF_01023} KW=Complete proteome OX=1394889 OS=Thermosynechococcus sp. NK55a. GN=NK55_00645 OC=Thermosynechococcus.
Sequence length 375
Sequence
MATFLRPELSNFRAYSTPTSDSLPLELDYLDTNEFPWDLPTALKEALAQQYVSTLGSHRY
PDSHHWPLRQAIARYVSEHSPTEISPHQIAVGNGSDELIRSILLATAIGGYGSILVAEPT
FSIYGILAQTLGIPVHRATRDPDTFAVQIAAANTLIAQAAPPVRVLFMLQPNSPTGNPLT
AAEVDWLRQLPEDILVVIDEAYFEFSGKTLVGDLAAHPNWLILRTFSKAFRLAAHRVGYA
IGNAEVIAVLEKVRLPYNLPTFSQVAAQVALDHRQALLAEIPTVLAERDQLYARLQSCPQ
LQVWPSVANFLFFRLREPQHTPPLWDALRSQGTLVRAIAGGIRVTIGTPAEMERFWQRLQ
AYLNQHDQSDNESDN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]