dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

V5V641 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|V5V641|V5V641_9CYAN) N-(5'-phosphoribosyl)anthranilate isomerase {ECO:0000256|HAMAP-Rule:MF_00135, ECO:0000256|SAAS:SAAS00786583} KW=Complete proteome OX=1394889 OS=Thermosynechococcus sp. NK55a. GN=NK55_07950 OC=Thermosynechococcus.
Sequence length 230
Sequence
MLNATTPVKIAVKICGLTLPEQAIAIAQMGVSALGFISVPHSPRYVSPPTIADICRQLPP
SVLTVAVVANLDFEALANLVTTTGVQALQLHGSESPEFCQSVRQTFPHIVLIKALRVRSA
ATLTEIAAYTPIVDRILLDAYHPQQLGGTGQPFDWTLLKELHIPCPWWLAGGITPENCRQ
AIAQTQPQGIDLASGVESRPGVKDLGRVAALLSNLGINANHSLYPEGSRF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]