dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

W4YVR3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|W4YVR3|W4YVR3_STRPU) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SPU_019919-tr} KW=Complete proteome; Reference proteome OX=7668 OS=Strongylocentrotus purpuratus (Purple sea urchin). GN= OC=Strongylocentrotus.
Sequence length 549
Sequence
MDRKKMGELLLFLILISCQTRSIQSAPLSSYLVSSFTPPGSDSTLPFNHIAINNITGDVY
IGARERLYQLDSDLNLKHTVNTEKCTDLDAGNVNDNKLLIVVTTPQKNTLLTCGGCDGYC
ESRSLTNISHDVMRYSKTSSQEVVTIGDVPTVGAVVLGSDFVDNGESTPNETFSLFTGVT
FKGRGTAQFISKHNLIDLSLVQNIQRGYVKSESLFKHLIVYKDYLYYFISRGNIVYLGRL
CRNSLDIELASYTEIELQCGSYNMIQSAHIGPAGSELGDSLNIDTTDALLYAVFSNESSS
FLCVYKMSDVQHSFESAVFGCIQGTSTGTINSNLLDTMCRSAPLLTLPDTVLCTAYYKED
NIPVPLYQYASGTVPIFASPIVTITDAIPTSIVATIERHHTVAFIGDTQGKLHKLNIVNG
SFGYVYENVSLGGGSVLQEVFLDESKEQLTLSTSSDQVSKVLTLDFVNCGQYQSCGECIG
EKGGNDGDPYCGWCTLDARCTRYEECPFPDESTRWLSYNALQCVSISDVHPDHRLPSQVT
EQEVGAIGT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]