dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

W5M828 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|W5M828|W5M828_LEPOC) Uncharacterized protein {ECO:0000313|Ensembl:ENSLOCP00000004536} KW=Complete proteome; Reference proteome OX=7918 OS=Lepisosteus oculatus (Spotted gar). GN= OC=Lepisosteus.
Sequence length 850
Sequence
MAERAGEEEGGVARSPLKRLRDPLSDGEQSRKSEAPEPQEVFKRRCYDVSGDENLNPMEQ
ARSPLKPLHRQVEMVVKPDTPAVASIKSRMNTLAAQRQQDEPSAVSGLEDQSGDQAALET
AVRGDVEFRSRVERFEARTPATEPIAPTSRPHSQSSIARTIQEKLLNSQGSSVSKANRLR
KEREEELRLVRLQSKSDNIWKKNDAEASLMEDAVVKADSQDSERKESDTANCSSAMYVSD
ADLTSQEEELNSSEMIDQIFEGVLDTTEDEVEPDCDDNGMSSREETEEQSGQQVTQEGNV
TTENSNNEQADDEKEKAEVDKHGDNNVDEELTFPPGSILSPLTKSVEAVVTPLRLMSGDA
PGPIPFHLTPSDLTETPPLYSIDAYRSLRQSTLRSYNSVTPTTNRKATEQTRTAQPHSVK
EKIKILNEEISKLQTIIYQTTQALNCCTDEEHGKGSLEEAEAEKLLLVSMEKRLSLLSEL
SRLKEPGASAGSAERGLETSPQEPCRGTLSISDVRLPLKVEFACSARTRAGRPSHYFFVL
IRYGSSNIVATPLATAADAKNGDTIAFPTSITLQDIRPNFEIDVEVYSLSHTTNACNSER
RPSKSKVTPKKLLTNITKSNHNQSSAVLPALGSSVRASNFSLVGSHKITLTSLGQNKFPL
DKIKFDGKVRKLLGDEFQEKVPFLSPLEGNIYLRLACQSHSNIEHRGFLTMFEDISGFGA
WHRRWVCLERGNLSYWNYPNDERSKPAVGCINLTNCTSQCVKPVNRDSCARPNTFELVKL
SQQKDAREILSKCWFSADTKEEREEWMEKLNQALLDHRTWKPVVSDQQTRQRDAPQDMSF
TSTHSRESIL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]