dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

W5Q175 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|W5Q175|W5Q175_SHEEP) N-acetylglucosamine-1-phosphate transferase alpha and beta subunits {ECO:0000313|Ensembl:ENSOARP00000016461} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=GNPTAB OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence length 1211
Sequence
VVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREQ
MEEEQKAMSREILGKNTTEPTKKSEKPLECLLTHCIKVPMLVLDPALPTNITLKDLPSLY
PSFHSASDVFNVAKPKNPSTNVSVVVFDTTKNVEDAQAGMFKGNSRQTVWRGYLTTDKEV
PGLVLMQDLAFLSGFPPTFKETNQLKAKLPENLSSKIKLLQLYSEASVALLKLNNPKDFQ
ELNKQTKKNMTINGKELTISPAYLLWDLSAISQSKQDEDVSASRFEDNEELRYSLRSIER
HAPWVRNIFIVTNGQIPSWLNLDNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGL
SQKFIYLNDDVMFGKDVWPDDFYSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNN
SACDWDGGDCSGNSGASRYIAGAGGTGSIGVGQPWHFGAGMTGVSYCNQGCANSWLADKF
CDQACNVLSCGFDAGDCGQDHFHELYKVTLLPNQTHYVIPKGECLPYFSFAEIAKKGIEG
AYSDNPIIRHASIANKWKTIHLLMHSGMNATTIHFNLTLQGKNDEEFKIQIVVEVDTREE
PKRNSTTQKAYHSLMSSTTLHPEAEILFEDIPEEKRFPKVKRHDVNTTRRFQVEVEIPQV
NISLLPKETQLSLNNLDLQLERGDITMKGYNLSKSALLRSFLMNPQNGKLTVNHPLTTEQ
RNGGLEAPLAKQVHRSNLGTSERLQESSPFPAVTVTVNNHSQSQIPPLGARFRAITVTPK
AGDRNVSREKLSSLTFPLESKDTQEKVITGKEQERKTEGNANSYPGGNEVVPGRKLQHYT
DSYLGFLPWEKKKYFQDLLDEEESLKTQLAYFTDSKHTGRQLKDTFADSLRYVNKILNSK
FGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAV
QPLNISQVFDEVDTDQSGILSDREIRTLATRIHDLPLSLQDLTGLEHMLINCSKMLPANI
TQLNNIPPTQEAYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDKNKYRFEIMGEEEIAFKM
IRTNVSHVVGQLDDIRKNPRKFVCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQFELP
REYRNRFLHMHELQEWRAYRDKLKFWTHCVLATLIMFTVFSFFAEQLIALKRKIFPRRRI
HKEASPDRIRV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]