dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

W7FAT4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|W7FAT4|W7FAT4_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR74235.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_01591 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence length 213
Sequence
MNNGEKTICTNRCVDEWISTKKDEWEKIRERFLNQYTVDESDKYFNVRSFLETFLVQIGA
ANHKDMVIKLSKFDNPCGCSAKANSKKSKDGNEDAIECMLKKLKDKIDDCNKNQAQNGAQ
SCTQTTPPETPDDEEDLLLEEGENENTLGKQQPSFCPPQKPEPVDESGCDPAKTEPEPPA
ASPAPSEDKSNQVPKSQEDEVPQEPPTPDKKGP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]