dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

W7JHM6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|W7JHM6|W7JHM6_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EWC78595.1} KW=Complete proteome; Reference proteome OX=1237627 OS=Plasmodium falciparum UGT5.1. GN=C923_00718 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence length 516
Sequence
MLCQYNGDDKKEHCNEYEEIDKTPQFLRWLEEWARKYCTEKSTRAREINETCEDDIINKI
HTYSIDNIPDEPCKTALTKYRNWYNNNYLHWENLKKKYESNKKNEKEQTTNGAHLSPSTT
TSFYKDDDAEAYVKRKCKECTCNYKDLQEEYKRITEGNNEVSTLIHRARIDSFDLKKRLF
YNILTLGSHYGFQAATNVISGLNRTISSFTRDQGQSRDSNSPDQTTQRDDGDEPPLPDGP
PGKVPATDQITNALLGSAIPLGVGIAFASLAYLLLKVKPKITSTRTNLFRVIDIPQNDYG
IPHKTSINRYVPYSSNLYKEKTYIYIEGEETDDYSYVRVISSSDITSSSEGEYEEMDIND
IYPYKSPTYKTLIEVVLKPSIKNEEAHNTEDAQDILIENMEDTNDTPTNKLTDEEWNKLR
NDFISQYLKDLPNGMDYQLPNEYTVDDNIYMDIEPNILHDSMDEKPFITQIQDRDLHNGK
QITYDINWNIQKRNEKLLVILQMIRNIFQIMIYILE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]