dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Dekbr2|34819|gw1.6.553.1 (Dekkera bruxellensis CBS 2499 v2.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 200
Sequence
ETKETTSSLPKPPTANVFAMFGGAKKTPVKKESAEEKAADEKEKKEEKAKKAEKSAEGED
DGIHFEPLVHLDKVEVKNNEEDEDVVFKIRAKMYRFAPETKEWKERGTGEVRFLKHKKIG
KTRLIMRRDKTFKVCANHYLAPEYQLKANIGSEKSWVYTCTGDVSDGKPEVQTFAIRFGS
KEKAQNFKEEFEKAQKENEK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]