dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Dekbr2|4330|gm1.739_g (Dekkera bruxellensis CBS 2499 v2.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 547
Sequence
MSTEYERIYLNQSKLPGRMRLAESGLGWKAQTLPGSTAKTSPFLLPTEEILTTSWSRGSR
GYEVCIDTKNRGVVMLDGFGKEDFASLKRELEKFFDIQLEQREHSLRGWNWGKTQLARNE
LVFNVSNKPAFEIPYSQIANTNMTGKNEVSVEMDLVDKSEIEKAGDELVELKLFIPGNME
KDEVEEINKKEEEEQSKTDNGSNTTSDKIVPLRTKALYFYDELKEKADLGQVVGEMIVSF
GEVLFLTPRGRYDIDMYDSFLRLRGKTYDYKVQYKQIQRIFSLPKVDGLHQLLILQVDPP
LRQGQTKYSFLTLQFDSQEEIEVELNLDDDEYEKKWKTRLNKTYSNYTYMVLTSIFKGFT
DRRVVVPGSFLTKDSDVAISCSVKANEGHLYPLDKCLIFVTKPTILLPFSDVHEVVFSRV
DTAGTHKTFDMEVVLKYGGGSHTFGNIDRKEQSALETFLKTRNLRVRNDEKIAQEMMAAA
LADDDDDGDLDLGSADEDSPDEDFKPGDENQEDDDIAEEYQSDVSASGEDDDEDMEDEEP
ERKKHKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]