dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSTTRP00000002134 (Tursiops truncatus 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1655:70511:73017:-1 gene:ENSTTRG00000002281 transcript:ENSTTRT00000002276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 306
Sequence
MGALTPWARYGLLVVAHLLALGLGAAVLQALGSPALQLXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYGHMAPLSAGGKAF
CVVYTALGLPASLALVAALRHCLLPLLSRPGAWVAIHWQLTPARAALLQASGLGLLVAGI
FVLLPALVLWGLQGDCGMLQAIYFCFSSLSTIGLGDLLPGHDNGLHPVFYYLGQFALLGY
LLLGLLAMLLTVETFLELPQVRAMVKFFRSRGPLNAEDEGGILGQDELALSTLPPSAAAP
ERAPAC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]