dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSTTRP00000016092 (Tursiops truncatus 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel scaffold:turTru1:scaffold_112842:21041:33727:1 gene:ENSTTRG00000016975 transcript:ENSTTRT00000016975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 676
Sequence
LAISRSSPLCPPSPMATAALRDPPEVGVTFEDIALYFSWEEWKLLDEAQRRLYHDVMLEN
FALISSLGVWSGEENVEASFEQNVSVVMSQVRTSKEPSSSQKTHPCEMCGPVLRDIFHLT
EQQGTQHSQKLFKRRACAKGFYFSADTQQHQEQHMQEKPFIIGVDRASFVKSSNFHVSGE
AFTCKKVAEDFLATSGHLNQQAIHTGEKPNTVTHAWKLYKAKSHCTRGECKKAFSPKHTL
VQAQSVYTERQCFMCSECGKTFKYKSSFVVHQRIHTGDRLYDCGDCGKSFRGSSALIQHR
RIHTGARQYKCSKCGKSFSQEFVFIYQQTVHTGEMSYECTERRKPFRRKSDLIEHWRVHT
GERPYECSECGKSFTSSSALRYHQRVHTGEKPYKCGECGKSFRKVFHLIIHRRVHTGERP
YECSECGKSFSHKSYLSQHQRVHTGERPYECSECGKSFRKSFTNGPILIRHRRVHTGERP
YECNECGKSFTQRNHLNIHQRVHTGERPYECIECGKSFTSGSALRYHQKIHIGERPYECS
ECEKSFTSSSALRCHQRVHTGERPFDCSECGKSFRDSSQLNQHQRVHTGEKPYECSDCGR
SFSQNSYLSKHRRVHTGERPYECSECEKSFTHNSGLIYHQRVHTGEKPYDCSECGKSFSR
KSNLSQHQRVHTGERP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]