dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gb|TGVEG_076390 (Toxoplasma gondii VEG)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | organism=Toxoplasma_gondii_VEG | product=conserved hypothetical protein | location=TGVEG_chrVIIb:3523452-3529294(+) | length=408
Sequence length 408
Sequence
MTDNAQTTSAEAGAANPSGEHPSAGAKRRQTLAAHELRDIQDGKAMDDVDQDSQPADDMK
QADAATLQKRQRLRIVRSAAAVPHPQGETTPGSPVTGSLSPAEKPVEAPKPSAEESASRE
TKDEQNAEGGKATNGVPENGKEGAGKSEKEQVGSSELLLGPAEIKSVQTFSSAFASLSKQ
PQSSFFLSPPQSNAGGETSGTPSLFASLASTSSLFSTSSVNKDNEDGADAEDEQKAEEPS
VIENEVDADEEILFTDRDCRMQRFDASQTAWAPKPPLEGRVQVSASKKPEDNGATRILFF
VHRTGRLQLNTPLFASANYQHPPDRSRQRAVPPRDEKPDDEKNGEEPLTEEMPKKRNTAQ
FLGLRTDAQSSSDTTIYRIRFSNEEKCAEFLSLANERKTKGKSQSTSA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]