dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSVPAP00000005507 (Vicugna pacos 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:vicPac1:GeneScaffold_1044:140530:181651:-1 gene:ENSVPAG00000005932 transcript:ENSVPAT00000005933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 347
Sequence
DRENWFCECPRLYSGKLCQFATCENNPCGNGATCVPKSGTDIICLCPYGRSGLLCTEXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
SGEDFLAVLRGGSVVYSYNLGSGTASISSDPLDLSRGVHTVHLGRSFRTGWLKXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCIFTLQVRTKKKGHFRSL
GSPEGHPSAGRSVGQCDASPCSLMQCGNGGTCVESGATVYCNCPSGWKGALCTETISTCD
PEHDPPHHCSQGATCVPLPRGYTCYCPLGTTGVYCEQGEAEPRLMPS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]